TA346449 PAGE4 antibody

Rabbit Polyclonal Anti-PAGE4 Antibody

See related secondary antibodies

Search for all "PAGE4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human PAGE4

Product Description for PAGE4

Rabbit anti Human PAGE4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PAGE4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G antigen family C member 1, GAGEC1, JM27, PAGE-4, Prostate-associated gene 4 protein
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60829
Immunogen:
The immunogen for anti-PAGE4 antibody: synthetic peptide directed towards the middle region of human PAGE4. Synthetic peptide located within the following region: PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ.
GeneID:
9506
Application WB
Background This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for PAGE4 (1 products)

Catalog No. Species Pres. Purity   Source  

PAGE4 overexpression lysate

PAGE4 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn