TA346481 CD299 / CLEC4M antibody

Rabbit Polyclonal Anti-CLEC4M Antibody

See related secondary antibodies

Search for all "CD299 / CLEC4M"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Porcine CD299 / CLEC4M

TA346481

More Views

  • TA346481

Product Description for CD299 / CLEC4M

Rabbit anti Human, Porcine CD299 / CLEC4M.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for CD299 / CLEC4M

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C-type lectin domain family 4 member M, CD209 antigen-like protein 1, CD209L, CD209L1, DC-SIGN-related protein, Dendritic cell-specific ICAM-3-grabbing non-integrin 2, Liver/lymph node-specific ICAM-3-grabbing non-integrin
Presentation Purified
Reactivity Hu, Por
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H2X3
Immunogen:
The immunogen for anti-CLEC4M antibody: synthetic peptide directed towards the N terminal of human CLEC4M. Synthetic peptide located within the following region: LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV.
GeneID:
10332
Application WB
IHC
Background CLEC4M is a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells. This gene is mapped to 19p13.3, in a cluster with the CD209 and CD23/FCER2 genes. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.
Format
Purification:
Protein A Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CD299 / CLEC4M (1 products)

Catalog No. Species Pres. Purity   Source  

CD299 / CLEC4M (transcript variant 1)

CD299 / CLEC4M Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for CD299 / CLEC4M (1 products)

Catalog No. Species Pres. Purity   Source  

CLEC4M overexpression lysate

CLEC4M overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn