DA3503XC FGF basic / FGF2

Search for all "FGF basic / FGF2"

50 µg / $240.00
Delivery Time: 10 working days*
(*) valid for US customers only

Quick Overview

FGF basic / FGF2

DA3503XC

More Views

  • DA3503XC
  • DA3503XC

Product Description for FGF basic / FGF2

FGF basic / FGF2.
Presentation: Purified

Properties for FGF basic / FGF2

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms BFGF, FGFB, Fibroblast growth factor 2 (basic), HBGF-2, HBGF2, Heparin-binding growth factor 2
Presentation Purified
Molecular weight 16.5 kDa
Source E. coli
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH

Datasheet Extract

Immunogen
Swiss Prot Num:
P09038
Purity > 98 % by SDS-PAGE and visualised by silver stain
Background The FGF family is composed of at least 22 polypeptides that show a variety of biological activities towards cells of mesenchymal, neuronal and epithelial origin. All members are heparin-binding growth factors (HBGF). Until the structure of basic fibroblast growth factor (bFGF/FGF-2) was determined, a number of synonyms was used to describe this growth factor. As is often the case, the nomenclature reflected the observed activities reported by individual groups. Basic FGF has been reported as leukemia growth factor, macrophage growth factor, endothelial growth factor and tumor angiogenesis factor. The eventual isolation and characterization of bFGF was done from soluble brain extracts. bFGF was found to have a molecular mass of 16 kDa and to be 154 amino acids in length. Interestingly, bFGF contains no hydrophobic leader sequence previously thougth to be required for cell secretion. Basic FGF bears 55% homology to acidic FGF and also seems to exist in three forms: the 154 amino-acid form and two other truncated versions of 146 and 131 amino acids lacking the N-terminal 9 and 24 residues. Acidic and basic FGF compete for the binding to 125 kDa and 145 kDa receptor species. However, acidic FGF has a higher affinity for the 125 kDa species, while basic FGF has a higher affinity for the 145 kDa species. FGF receptor activation leads to the activation of MAP kinase and protein kinase C. FGF's induce the proliferative response in cells derived from mesoderm and neuroectoderm. It seems that basic FGF reduces the average doubling time by shortening the G1 phase of the cell cycle. Furthermore, it has been reported to induce the release of plasminogen activator by endothelial cells. Perhaps one of the most potentially significant applications of bFGF is related to its reported ability to induce angiogenesis.
General Readings
  1. Quarto N et al, Gene 356:49, (2005).  
  2. Tsuneto M et al, Biochem Biophys Res Comm 335:1239 (2005).  
  3. Presta M et al, Cytokine Growth Factor Rev 16:159, (2005). 
  4. Claus P et al, J Biol Chem 278:479, (2003).
  5. Coulier F et al, J Mol Evol 44:43, (1997).
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Recombinant Human Fibroblast Growth Factor-2 (basic).
Result by N-terminal sequencing: AGSITTL
AA Sequence:
AGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVC ANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRGQYKLGSKTGPGQKAILFLPMSAKS
Biological activity:
The ED50 for stimulation of cell proliferation in Human umbilical vein endothelial cells by Human FGF-2 (basic) has been determined to be in the range of 0.1-2 ng/ml.
Molecular weight:
(153 amino acids)
Format
Buffer System:
PBS
Stabilizers:
None
Endotoxin level:
< 0.1 ng per µg of FGF-basic
Purity:
>98% by SDS-PAGE and visualised by silver stain
State:
Lyophilized purified protein
Purified
Reconstitution:
Restore in water containing at least 0.1% Human or Bovine Serum Albumin to a concentration not lower than 10 μg/ml.
  • LinkedIn