TA339546 UNC84A antibody

Rabbit Polyclonal Anti-SUN1 Antibody

See related secondary antibodies

Search for all "UNC84A"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat UNC84A

TA339546

More Views

  • TA339546
  • TA339546

Product Description for UNC84A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat UNC84A.
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for UNC84A

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms KIAA0810, Protein unc-84 homolog A, SUN1, Sad1/unc-84 protein-like 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications ICC/IF, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O94901
Immunogen:
The immunogen for anti-UNC84A antibody: synthetic peptide directed towards the N terminal of human UNC84A. Synthetic peptide located within the following region: QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA.
GeneID:
23353
Application WB
IF
Background UNC84A is a a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration.This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several altertively spliced transcript variants of this gene have been described; however, the full-length ture of some of these variants has not been determined.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for UNC84A (2 products)

Catalog No. Species Pres. Purity   Source  

SUN1 overexpression lysate

SUN1 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.

SUN1 overexpression lysate

SUN1 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn