TA338472 TMEM35 antibody

Rabbit Polyclonal Anti-TMEM35 Antibody

See related secondary antibodies

Search for all "TMEM35"

50 µg / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TMEM35

Product Description for TMEM35

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TMEM35.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM35

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Transmembrane protein 35
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q53FP2
Immunogen:
The immunogen for anti-TMEM35 antibody: synthetic peptide directed towards the C terminal of human TMEM35. Synthetic peptide located within the following region: VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS.
GeneID:
59353
Application WB
Background TMEM35 is a multi-pass membrane protein. The exact function of TMEM35 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM35 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM35

TMEM35 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $680.00
  OriGene Technologies, Inc.

Positive controls for TMEM35 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM35 overexpression lysate

TMEM35 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn