TA330775 TMED5 antibody

Rabbit Polyclonal Anti-TMED5 Antibody

See related secondary antibodies

Search for all "TMED5"

50 µg / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TMED5

Product Description for TMED5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TMED5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMED5

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CGI-100, Transmembrane emp24 domain-containing protein 5, UNQ397/PRO733
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y3A6
Immunogen:
The immunogen for Anti-TMED5 antibody is: synthetic peptide directed towards the C-terminal region of Human TMED5. Synthetic peptide located within the following region: INSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVV.
GeneID:
50999
Application WB
Background TMED5 is a potential role in vesicular protein trafficking, mainly in the early secretory pathway. It is required for the maintence of the Golgi apparatus; involved in protein exchange between Golgi stacks during assembly. It probably not required for COPI-vesicle-mediated retrograde transport.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn