TA334033 SUPT5H antibody

Rabbit Polyclonal Anti-SUPT5H Antibody

See related secondary antibodies

Search for all "SUPT5H"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog SUPT5H

TA334033

More Views

  • TA334033
  • TA334033
  • TA334033

Product Description for SUPT5H

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog SUPT5H.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SUPT5H

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms DRB sensitivity-inducing factor large subunit, DSIF p160, DSIFp160, SPT5, SPT5H, Tat-CT1 protein, Tat-cotransactivator 1 protein, Transcription elongation factor SPT5
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Chk, Hu, Ms, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00267
Immunogen:
The immunogen for anti-SUPT5H antibody: synthetic peptide directed towards the C terminal of human SUPT5H
AA Sequence:
PYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQA
GeneID:
6829
Application Western blotting (0.2 - 1 µg/ml)
Immunohistochemsitry on paraffin embedded sections (2 - 8 µg/ml)
Background SUPT5H and its binding partner regulate transcriptional elongation by RNA polymerase II. SPT4 and SPT5 are involved in both 5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole (DRB)-mediated transcriptional inhibition and the activation of transcriptional elongation by the human immunodeficiency virus type 1 (HIV-1) Tat protein.
General Readings Bourgeois,C.F., et al., (2002) Mol. Cell. Biol. 22 (4), 1079-1093
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Bovine, African clawed frog, Chicken, Zebrafish
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for SUPT5H (4 products)

Catalog No. Species Pres. Purity   Source  

SUPT5H (transcript variant 1)

SUPT5H Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

SUPT5H (transcript variant 4)

SUPT5H Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

SUPT5H (transcript variant 2)

SUPT5H Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

SUPT5H (transcript variant 3)

SUPT5H Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

Positive controls for SUPT5H (1 products)

Catalog No. Species Pres. Purity   Source  

SUPT5H overexpression lysate

SUPT5H overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn