TA341734 MDC1 antibody

Rabbit Polyclonal Anti-MDC1 Antibody

See related secondary antibodies

Search for all "MDC1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Guinea Pig, Human MDC1

Product Description for MDC1

Rabbit anti Canine, Guinea Pig, Human MDC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MDC1

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms KIAA0170, MDC1, Mediator of DNA damage checkpoint protein 1, NFBD1
Presentation Purified
Reactivity Can, GP, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14676
Immunogen:
The immunogen for anti-MDC1 antibody: synthetic peptide directed towards the C terminal of human MDC1. Synthetic peptide located within the following region: GKEEDVVTPKPGKRKRDQAEEEPNRIPSRSLRRTKLNQESTAPKVLFTGV.
GeneID:
9656
Application WB
Background The protein encoded byThis gene contains an N-termil forkhead domain, two BRCA1 C-termil (BRCT) motifs and a central domain with 13 repetitions of an approximately 41-amino acid sequence.The encoded protein is required to activateThe intra-S phase and G2/M phase cell cycle checkpoints in response to D damage.This nuclear protein interacts with phosphorylated histone H2AX near sites of D double-strand breaks through its BRCT motifs, and facilitates recruitment ofThe ATM kise and meiotic recombition 11 protein complex to D damage foci. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn