TA342268 HOXB7 / HOX2C antibody

Rabbit Polyclonal Anti-Hoxb7 Antibody

See related secondary antibodies

Search for all "HOXB7 / HOX2C"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat HOXB7 / HOX2C

Product Description for HOXB7 / HOX2C

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat HOXB7 / HOX2C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXB7 / HOX2C

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms HHO.C1, Homeobox protein Hox-B7, Hox-2C
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P09629
Immunogen:
The immunogen for anti-Hoxb7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PGDPAKAAGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTL.
GeneID:
3217
Application WB
Background Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positiol identities on the anterior-posterior axis.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 15% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXB7 / HOX2C (1 products)

Catalog No. Species Pres. Purity   Source  

HOXB7 / HOX2C

HOXB7 / HOX2C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for HOXB7 / HOX2C (1 products)

Catalog No. Species Pres. Purity   Source  

HOXB7 overexpression lysate

HOXB7 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn