TA335851 HOXB1 / HOX2I antibody

Rabbit Polyclonal Anti-HOXB1 Antibody

See related secondary antibodies

Search for all "HOXB1 / HOX2I"

50 µg / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HOXB1 / HOX2I

Product Description for HOXB1 / HOX2I

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HOXB1 / HOX2I.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXB1 / HOX2I

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Homeobox protein Hox-B1, Hox-2I
Presentation Purified
Reactivity Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-HOXB1 Antibody: synthetic peptide directed towards the C terminal of human HOXB1. Synthetic peptide located within the following region: FQNRRMKQKKREREEGRVPPAPPGCPKEAAGDASDQSTCTSPEASPSSVT.
Application WB
Background This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXB1 / HOX2I (1 products)

Catalog No. Species Pres. Purity   Source  


HOXB1 / HOX2I Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for HOXB1 / HOX2I (1 products)

Catalog No. Species Pres. Purity   Source  

HOXB1 overexpression lysate

HOXB1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn