TA340100 Cyclophilin H / PPIH antibody

Rabbit Polyclonal Anti-PPIH Antibody

See related secondary antibodies

Search for all "Cyclophilin H / PPIH"

50 µg / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish Cyclophilin H / PPIH

Product Description for Cyclophilin H / PPIH

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish Cyclophilin H / PPIH.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cyclophilin H / PPIH

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CYP20, CYPH, PPIase H, Peptidyl-prolyl cis-trans isomerase H, Rotamase H, Small nuclear ribonucleoprotein particle-specific cyclophilin H, SnuCyp-20, U-snRNP-associated cyclophilin SnuCyp-20, USA-CYP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43447
Immunogen:
The immunogen for anti-PPIH antibody: synthetic peptide directed towards the N terminal of human PPIH. Synthetic peptide located within the following region: VVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDG.
GeneID:
10465
Application WB
Background The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mR processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cyclophilin H / PPIH (4 products)

Catalog No. Species Pres. Purity   Source  

Cyclophilin H / PPIH

Cyclophilin H / PPIH Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $680.00
  OriGene Technologies, Inc.

Cyclophilin H / PPIH

Cyclophilin H / PPIH Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / $399.00
  OriGene Technologies, Inc.

Cyclophilin H / PPIH (1-177)

Cyclophilin H / PPIH Human Purified > 95 % by SDS PAGE E. coli
0.5 mg / $1,020.00
  OriGene Technologies GmbH

Cyclophilin H / PPIH (1-177)

Cyclophilin H / PPIH Human Purified > 95 % by SDS PAGE E. coli
0.1 mg / $420.00
  OriGene Technologies GmbH
  • LinkedIn