TA338367 CACNB3 antibody

Rabbit Polyclonal Anti-CACNB3 Antibody

See related secondary antibodies

Search for all "CACNB3"

0.1 mg / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CACNB3

Product Description for CACNB3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CACNB3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CACNB3

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CAB3, CACNLB3, Calcium channel voltage-dependent subunit beta 3, Voltage-dependent L-type calcium channel subunit beta-3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the C terminal of human CACNB3. Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH.
Application WB
Background This gene encodes a regulatory beta subunit of the voltage-dependent calcium channel. Beta subunits are composed of five domains, which contribute to the regulation of surface expression and gating of calcium channels and may also play a role in the regulation of transcription factors and calcium transport. [provided by RefSeq, Oct 2011].
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for CACNB3 (1 products)

Catalog No. Species Pres. Purity   Source  


CACNB3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $438.00
  OriGene Technologies, Inc.
  • LinkedIn