TA335477 C20orf195 antibody

Rabbit Polyclonal Anti-C20orf195 Antibody

See related secondary antibodies

Search for all "C20orf195"

50 µg / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat C20orf195

Product Description for C20orf195

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat C20orf195.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C20orf195

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Uncharacterized protein C20orf195
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BVV2
Immunogen:
The immunogen for Anti-C20orf195 Antibody: synthetic peptide directed towards the N terminal of human C20orf195. Synthetic peptide located within the following region: RMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDPRPFLADWALV.
GeneID:
79025
Application WB
Background The exact function of C20orf195 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C20orf195 (1 products)

Catalog No. Species Pres. Purity   Source  

C20orf195

C20orf195 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $680.00
  OriGene Technologies, Inc.

Positive controls for C20orf195 (1 products)

Catalog No. Species Pres. Purity   Source  

C20orf195 overexpression lysate

C20orf195 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn