TA340323 ALS2CR12 antibody

Rabbit Polyclonal Anti-ALS2CR12 Antibody

See related secondary antibodies

Search for all "ALS2CR12"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human ALS2CR12

Product Description for ALS2CR12

Rabbit anti Human ALS2CR12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ALS2CR12

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96Q35
Immunogen:
The immunogen for anti-ALS2CR12 antibody: synthetic peptide directed towards the N terminal of human ALS2CR12. Synthetic peptide located within the following region: SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP.
GeneID:
130540
Application WB
Background The exact function of ALS2CR12 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn