TA346213 Alcohol dehydrogenase 1B / ADH2 antibody

Rabbit Polyclonal Anti-ADH1B Antibody

See related secondary antibodies

Search for all "Alcohol dehydrogenase 1B / ADH2"

0.1 mg / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Alcohol dehydrogenase 1B / ADH2


More Views

  • TA346213

Product Description for Alcohol dehydrogenase 1B / ADH2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Alcohol dehydrogenase 1B / ADH2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Alcohol dehydrogenase 1B / ADH2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms ADH1B, Alcohol dehydrogenase subunit beta
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the C terminal of human ADH1B. Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV.
Application WB
Background ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.The protein encoded by this gene is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This encoded protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster.
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Alcohol dehydrogenase 1B / ADH2 (1 products)

Catalog No. Species Pres. Purity   Source  

Alcohol dehydrogenase 1B / ADH2

Alcohol dehydrogenase 1B / ADH2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $438.00
  OriGene Technologies, Inc.
  • LinkedIn